PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000626215
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family NAC
Protein Properties Length: 97aa    MW: 10814.7 Da    PI: 9.0697
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000626215genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM514.9e-161869152
            NAM  1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvk 52
                   l++G+rFhPt eel+++yLk k++g +  ++++i+e++i+++ePw+Lp+ ++
  MDP0000626215 18 LQVGYRFHPTKEELISHYLKLKLRGMDSLVSDAIREINICNYEPWELPALYE 69
                   578************************99999***************96433 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.53E-16868IPR003441NAC domain
PROSITE profilePS5100517.3641896IPR003441NAC domain
PfamPF023651.4E-62062IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 97 aa     Download sequence    Send to blast
MASNGIRFTR VEVGGMLLQV GYRFHPTKEE LISHYLKLKL RGMDSLVSDA IREINICNYE  60
PWELPALYEA SSKPEAGGVL VVKLKSIWLG SKGFLF*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008347198.12e-42PREDICTED: NAC domain-containing protein 69-like
RefseqXP_008376275.17e-41PREDICTED: NAC domain-containing protein 19-like
SwissprotQ9M1264e-15NAC69_ARATH; NAC domain-containing protein 69
TrEMBLA0A087GLE48e-17A0A087GLE4_ARAAL; Uncharacterized protein
TrEMBLM5XNS92e-17M5XNS9_PRUPE; Uncharacterized protein
STRINGBra008553.1-P2e-14(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13478522
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G01550.12e-16NAC domain containing protein 69